Cagrilintide 10mg

Description

Long-acting synthetic amylin analogue for obesity and metabolic research.

Cagrilintide is a long-acting acylated amylin analogue engineered for extended receptor engagement at the amylin receptor complex (AMY1 and AMY3). Its mechanism involves activating calcitonin and amylin receptors in the area postrema and hypothalamus, modulating satiety signaling and gastric emptying. Compared to pramlintide, the only previously available amylin analogue, cagrilintide offers a substantially longer half-life (approximately 7 days vs. Research also indicates potential benefits in alcohol-related liver disease models, where amylin signaling may reduce hepatic lipid accumulation. The lyophilized powder should be stored at -20C prior to reconstitution with sterile water or bacteriostatic water; reconstituted solutions should be refrigerated at 2-8C. This compound is primarily studied by obesity research institutes, pharmaceutical laboratories investigating incretin-amylin synergy, and academic centers focused on appetite neurobiology and hepatic metabolism.

This product is supplied as a lyophilized powder and is intended for laboratory and research use only. Not for human consumption. Each vial contains 10mg of research-grade material.

Research Applications

• Metabolic and glucose-regulation research
• Incretin-pathway combination research
• Hepatic-injury models
• Cardiovascular condition exploration

Specifications

Size

10mg

Purity

≥98% (HPLC)

Form

Lyophilized Powder

Molecular Formula

C194H312N54O59S2

Molecular Weight

4409.01 g/mol

CAS Number

1415456-99-3

Sequence

XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Storage & Handling

• Long-term storage: -20°C in a sealed, light-protected container
• Short-term storage: 2-8°C (refrigerated) for up to 30 days
• Reconstituted: Store at 2-8°C and use within 30 days
• Avoid: Repeated freeze-thaw cycles, direct sunlight, and moisture exposure
• Reconstitution: Use bacteriostatic water or sterile water for injection